PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G13350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 222aa    MW: 25144 Da    PI: 8.1454
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G13350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.71.3e-17957149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     kri+n   rqv fskRr  ++KKA+EL +LC+aeva+++ s+ g+++ +
  LPERR06G13350.1  9 KRIKNVGARQVCFSKRRPSVFKKASELYTLCGAEVAMLVKSPAGNIFSF 57
                     79******************************************99877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.651161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-22173IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-22160IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-15323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-191057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MTKRKIEIKR IKNVGARQVC FSKRRPSVFK KASELYTLCG AEVAMLVKSP AGNIFSFGAP  60
SVRSVLCRSR HTSVGEYSSM AIAMQNGDSA TITLHELTQQ HIELENQLKD QNEKMRSLQQ  120
AIKQEAEGKV MCWLDGKVED LCKDDLEEFN MVLLSLNDMI KGMTNQLFHN YTMFSHMMYM  180
QHCVTTVPNQ QFLLNSEDVK PIIHHVPSSS NGWNIGMDGN PN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642726.11e-112PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A0D9WQL61e-169A0A0D9WQL6_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g22760.11e-111(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169561112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.16e-23AGAMOUS-like 61